Iright
BRAND / VENDOR: Proteintech

Proteintech, 20446-1-AP, C10orf58 Polyclonal antibody

CATALOG NUMBER: 20446-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C10orf58 (20446-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf58 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 20446-1-AP targets C10orf58 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: ROS1728 cells Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: ROS1728 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C10orf58, also name as FAM213A and PAMM, is involved in redox regulation of the cell. It acts as an antioxidant. C10orf58 inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation. It may affect bone resorption and help to maintain bone mass. The MW of C10orf58 is 24-30 kDa. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14272 Product name: Recombinant human C10orf58 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-229 aa of BC005871 Sequence: DVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK Predict reactive species Full Name: chromosome 10 open reading frame 58 Calculated Molecular Weight: 229 aa, 26 kDa Observed Molecular Weight: 24-30 kDa GenBank Accession Number: BC005871 Gene Symbol: C10orf58 Gene ID (NCBI): 84293 RRID: AB_2878687 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924