Proteintech, 20456-1-AP, EI24 Polyclonal antibody

Size: 20ul / 150ul The EI24 (20456-1-AP) by Proteintech is a Polyclonal antibody targeting EI24 in WB, IHC, ELISA applications with reactivity to human samples 20456-1-AP targets EI24 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HT-1080 cells, HeLa cells, L02 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ei24 is an ER-localized protein originally identified as a p53-induced proapoptotic gene in etoposide-treated NIH3T3 cells. It has been shown to be able to bind to the antiapoptotic protein Bcl-2 (PMID: 15781622), play a role in autophagy (PMID: 23074225), and induce proliferate arrest/apoptosis (PMID: 10594026). Ei24 can bind specifically to IMPβ1 and IMPα2 to impede their normal role in nuclear import (PMID: 24821838). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14169 Product name: Recombinant human EI24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 267-340 aa of BC002390 Sequence: SILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH Predict reactive species Full Name: etoposide induced 2.4 mRNA Calculated Molecular Weight: 340 aa, 39 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC002390 Gene Symbol: EI24 Gene ID (NCBI): 9538 RRID: AB_10858326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14681 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.