Iright
BRAND / VENDOR: Proteintech

Proteintech, 20458-1-AP, SLC39A3 Polyclonal antibody

CATALOG NUMBER: 20458-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC39A3 (20458-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A3 in IHC, ELISA applications with reactivity to human, mouse samples 20458-1-AP targets SLC39A3 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC39A3, also known as ZIP3 (Zrt- and Irt-like protein 3), is a solute carrier family 39 (SLC39) and is critical in maintaining cellular zinc homeostasis (PMID: 32744318). SLC39A3 is a multi-pass membrane protein that belongs to the ZIP family of zinc transporters responsible for the influx of zinc into cells from the extracellular space. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14289 Product name: Recombinant human SLC39A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-180 aa of BC005869 Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 3 Calculated Molecular Weight: 314 aa, 34 kDa GenBank Accession Number: BC005869 Gene Symbol: SLC39A3 Gene ID (NCBI): 29985 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRY0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924