Iright
BRAND / VENDOR: Proteintech

Proteintech, 20459-1-AP, ZIP8 Polyclonal antibody

CATALOG NUMBER: 20459-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZIP8 (20459-1-AP) by Proteintech is a Polyclonal antibody targeting ZIP8 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 20459-1-AP targets ZIP8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, mouse heart tissue, mouse liver tissue, mouse lung tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human kidney tissue, human placenta tissue, mouse lung tissue, mouse small intestine tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC39A8, also known as ZIP8, belongs to the ZIP family of metal ion transporters which function to transport zinc and/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Recently it was found that ZIP8 expression is upregulated in human monocytes in response to LPS, TNF-α, and live bacteria, facilitating cytoprotection during the early inflammation. Besides zinc ZIP8 can also transport cadmium and manganese efficiently. It is predicted that ZIP8 contains 3 potential N-linked glycosylation sites and is subject to glycosylation, which may account for the presences of multiple molecular weights, such as 43 kDa, 49 kDa, 60 kDa, 75-90 kDa, 150 kDa, and 200 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14292 Product name: Recombinant human SLC39A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-143 aa of BC012125 Sequence: LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 8 Calculated Molecular Weight: 460 aa, 50 kDa Observed Molecular Weight: 42-46 kDa, 75-90 kDa,150 kDa GenBank Accession Number: BC012125 Gene Symbol: ZIP8 Gene ID (NCBI): 64116 RRID: AB_10697830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0K1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924