Iright
BRAND / VENDOR: Proteintech

Proteintech, 20469-1-AP, SLC37A2 Polyclonal antibody

CATALOG NUMBER: 20469-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC37A2 (20469-1-AP) by Proteintech is a Polyclonal antibody targeting SLC37A2 in WB, ELISA applications with reactivity to human, mouse, rat samples 20469-1-AP targets SLC37A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, HeLa cells, RAW 264.7 cells, mouse spleen tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:300-1:600 Background Information The solute carrier family 37 (SLC37) consists of four sugar-phosphate exchangers, A1, A2, A3, and A4, which are anchored in the endoplasmic reticulum (ER) membrane (PMID:23506893). Solute Carrier Family 37 Member 2 (SLC37A2), also knows as SPX2, was firstly identified in a work, conducted on mice and aimed to detect cAMP inducible genes playing a role in promoting cholesterol efflux from the macrophage cell line RAW264 via apoE and apoA1 (PMID:11004510). Interestingly, of the four SLC37A members, SLC37A2 displays the highest level of transcript abundance in neutrophils and macrophages ,indicating that SLC37A2 may play an essential role in regulating innate immune function (PMID:32428862). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14306 Product name: Recombinant human SLC37A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-313 aa of BC051314 Sequence: VMGVITFLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEFSLCLLFAKLVSYT Predict reactive species Full Name: solute carrier family 37 (glycerol-3-phosphate transporter), member 2 Calculated Molecular Weight: 505 aa, 55 kDa Observed Molecular Weight: 50-75 kDa GenBank Accession Number: BC051314 Gene Symbol: SLC37A2 Gene ID (NCBI): 219855 RRID: AB_10733754 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TED4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924