Iright
BRAND / VENDOR: Proteintech

Proteintech, 20478-1-AP, WDR40A Polyclonal antibody

CATALOG NUMBER: 20478-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WDR40A (20478-1-AP) by Proteintech is a Polyclonal antibody targeting WDR40A in WB, IHC, ELISA applications with reactivity to human samples 20478-1-AP targets WDR40A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IHC detected in: human lung cancer tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WDR40A, also known as DCAF12, is a 51 kDa protein. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex(PMID: 16949367). This antibody specifically recognises the 51 kDa protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14349 Product name: Recombinant human WDR40A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC008893 Sequence: LHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFHLGT Predict reactive species Full Name: WD repeat domain 40A Calculated Molecular Weight: 453 aa, 51 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC008893 Gene Symbol: WDR40A Gene ID (NCBI): 25853 RRID: AB_2878692 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T6F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924