Proteintech, 20507-1-AP, DMT1 Polyclonal antibody

Size: 20ul / 150ul The DMT1 (20507-1-AP) by Proteintech is a Polyclonal antibody targeting DMT1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 20507-1-AP targets DMT1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HuH-7 cells, Caco-2 cells, COLO 320 cells, rat kidney tissue, Neuro-2a cells, SH-SY5Y cells Positive IHC detected in: mouse small intestine tissue, human pancreas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue, mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SLC11A2 (also known as DMT1, Nramp2, and DCT1) is a member of the divalent cation transporters that play a central role in iron homeostasis. SLC11A2 is widely expressed in many tissues including the brain, kidney, testis, duodenum, and placenta. As a membrane protein, SLC11A2 is localized on the apical membrane of enterocytes as well as in transferrin-cycle endosomes. Four isoforms of SLC11A2 exist due to the alternative splicing. They differ at the NH2 and COOH termini but share a common central domain. A variety of molecular weights of SLC11A2 in western blot analysis, ranging from 50 to 100 kDa, has been reported in different cells and species. The differences in molecular weights may be attributed to the level of glycosylation, proteolysis, or the membrane protein itself. This antibody detected various forms of SLC11A2 of 45-100 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14314 Product name: Recombinant human SLC11A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC002592 Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLM Predict reactive species Full Name: solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 Calculated Molecular Weight: 568 aa, 62 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC002592 Gene Symbol: DMT1 Gene ID (NCBI): 4891 RRID: AB_10694284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49281 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.