Proteintech, 20514-1-AP, BTG4 Polyclonal antibody

Size: 20ul / 150ul The BTG4 (20514-1-AP) by Proteintech is a Polyclonal antibody targeting BTG4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20514-1-AP targets BTG4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, HeLa cells, mouse colon tissue Positive IHC detected in: human ovary tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14339 Product name: Recombinant human BTG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC031045 Sequence: MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQV Predict reactive species Full Name: B-cell translocation gene 4 Calculated Molecular Weight: 223 aa, 26 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC031045 Gene Symbol: BTG4 Gene ID (NCBI): 54766 RRID: AB_10694822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.