Product Description
Size: 20ul / 150ul
The LAYN (20535-1-AP) by Proteintech is a Polyclonal antibody targeting LAYN in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples
20535-1-AP targets LAYN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A549 cells, mouse brain tissue, NCI-H1299 cells
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100
Specification
Tested Reactivity: human, mouse
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14508 Product name: Recombinant human LAYN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC025407 Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY Predict reactive species
Full Name: layilin
Calculated Molecular Weight: 382 aa, 43 kDa
Observed Molecular Weight: 43 kDa
GenBank Accession Number: BC025407
Gene Symbol: LAYN
Gene ID (NCBI): 143903
RRID: AB_10696315
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6UX15
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924