Proteintech, 20597-1-AP, CD9 Polyclonal antibody

Size: 20ul / 150ul The CD9 (20597-1-AP) by Proteintech is a Polyclonal antibody targeting CD9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20597-1-AP targets CD9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, HeLa cells, L02 cells, HEK-293-derived exosomes Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, human endometrial cancer tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, it may be due to the difference of glycosylations (PMID: 8701996). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, rabbit, monkey, chicken, zebrafish, goat, bat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14546 Product name: Recombinant human CD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species Full Name: CD9 molecule Calculated Molecular Weight: 228 aa, 25 kDa Observed Molecular Weight: 23-30 kDa GenBank Accession Number: BC011988 Gene Symbol: CD9 Gene ID (NCBI): 928 RRID: AB_2878706 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21926 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.