Proteintech, 20599-1-AP, ZNF486 Polyclonal antibody

Size: 20ul / 150ul The ZNF486 (20599-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF486 in WB, ELISA applications with reactivity to human samples 20599-1-AP targets ZNF486 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14567 Product name: Recombinant human ZNF486 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-259 aa of BC008936 Sequence: MESLQFRDVAVEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIIVSKPDLITCLEQGIKPLTMKRHEMIAKPPVVCSHFAQDLWPEQSIKDSYQKVILRKFEKCGHGNLHFKKGCESVDECKLHKRGYNGLNQCLTTTQSKIFQCGKYVKVFHQFSNSKRHKRRHTEKKPLKYIEGDKAFNQSSTHTTHKKIDTGEKPYKCEECGKAFNRSSCL Predict reactive species Full Name: zinc finger protein 486 Calculated Molecular Weight: 463 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC008936 Gene Symbol: ZNF486 Gene ID (NCBI): 90649 RRID: AB_2878707 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96H40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.