Product Description
Size: 20ul / 150ul
The SLC37A4 (20612-1-AP) by Proteintech is a Polyclonal antibody targeting SLC37A4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
20612-1-AP targets SLC37A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, HeLa cells, mouse kidney tissue, mouse liver tissue, rat liver tissue
Positive IHC detected in: human kidney tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14660 Product name: Recombinant human SLC37A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC015650 Sequence: MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIF Predict reactive species
Full Name: solute carrier family 37 (glucose-6-phosphate transporter), member 4
Calculated Molecular Weight: 429 aa, 46 kDa
Observed Molecular Weight: 46 kDa
GenBank Accession Number: BC015650
Gene Symbol: SLC37A4
Gene ID (NCBI): 2542
RRID: AB_10858386
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O43826
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924