Proteintech, 20614-1-AP, PEX7 Polyclonal antibody

Size: 20ul / 150ul The PEX7 (20614-1-AP) by Proteintech is a Polyclonal antibody targeting PEX7 in WB, ELISA applications with reactivity to human, mouse, rat samples 20614-1-AP targets PEX7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PEX7, also known as peroxisomal targeting signal 2 (PTS2) receptor, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively. PEX7 plays an essential role in peroxisomal protein import by binding to the N-terminal PTS2-type peroxisomal targeting signal. PEX7 defects are associated with peroxisome biogenesis disorder complementation group 11 (PBD-CG11), rhizomelic chondrodysplasia punctata type 1 (RCDP1) and Refsum disease. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14666 Product name: Recombinant human PEX7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-323 aa of BC006268 Sequence: GEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSLQSPTQVADCSWDETIKIYDPACLTIPA Predict reactive species Full Name: peroxisomal biogenesis factor 7 Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC006268 Gene Symbol: PEX7 Gene ID (NCBI): 5191 RRID: AB_10694826 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00628 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.