Iright
BRAND / VENDOR: Proteintech

Proteintech, 20621-1-AP, STC1 Polyclonal antibody

CATALOG NUMBER: 20621-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STC1 (20621-1-AP) by Proteintech is a Polyclonal antibody targeting STC1 in WB, IHC, ELISA applications with reactivity to human samples 20621-1-AP targets STC1 in WB, IHC, IP, ELISA, Cell treatment applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, SW480 cells, U-251 cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information STC1, also named as stanniocalcin 1, a 56kDa homodimeric glycoprotein hormone, is highly expressed in a variety of cancers such as breast, ovarian, and colorectal cancers (PMID: 27459971). This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. STC1 is implicated in several pathologies including retinal degeneration, cerebral ischemia, angiogenesis and inflammation (PMID: 25391215). The calculated molecular weight of STC1 is usually approximately 28 kda. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14697 Product name: Recombinant human STC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 98-247 aa of BC029044 Sequence: CIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA Predict reactive species Full Name: stanniocalcin 1 Calculated Molecular Weight: 247 aa, 28 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC029044 Gene Symbol: STC1 Gene ID (NCBI): 6781 RRID: AB_10694290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52823 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924