Iright
BRAND / VENDOR: Proteintech

Proteintech, 20624-1-AP, mDia1 Polyclonal antibody

CATALOG NUMBER: 20624-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The mDia1 (20624-1-AP) by Proteintech is a Polyclonal antibody targeting mDia1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, monkey samples 20624-1-AP targets mDia1 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: HeLa cells, human heart tissue, human skeletal muscle tissue, COS-7 cells, NIH/3T3 cells, MDA-MB-231 cells, HUVEC cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information mDia1, also known as DIAPH1 or Diap1, is a mammalian diaphanous-related formin which is implicated in multiple physical and pathological events including cytoskeletal dynamics, autosomal hearing loss, and myelodysplasia. Depending upon the cell type and position in the cell cycle, mDia1 has been shown to localize to the cell cortex, trafficking endosomes, cleavage furrow, mid-bodies, and centrosomes, the cytoplasmic microtubule-organizing center crucial for cell division. Mutation of mDia1 has been linked to microcephaly. This antibody recognizes the endogenous mDia1 mainly around 140-150 kDa, while sometimes an additional 70 kDa can also be observed which is proposed to be a fragment of 140-150 kDa molecules (26011179). Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14523 Product name: Recombinant human DIAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1211-1272 aa of BC007411 Sequence: AFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS Predict reactive species Full Name: diaphanous homolog 1 (Drosophila) Calculated Molecular Weight: 1272 aa, 141 kDa Observed Molecular Weight: 140-150 kDa, 70 kDa GenBank Accession Number: BC007411 Gene Symbol: mDia1 Gene ID (NCBI): 1729 RRID: AB_10858618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924