Iright
BRAND / VENDOR: Proteintech

Proteintech, 20631-1-AP, WDR74 Polyclonal antibody

CATALOG NUMBER: 20631-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WDR74 (20631-1-AP) by Proteintech is a Polyclonal antibody targeting WDR74 in WB, IHC, ELISA applications with reactivity to human samples 20631-1-AP targets WDR74 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells Positive IHC detected in: human hepatocellular carcinomaNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WDR74, also known as WD repeat domain 74, is a protein-coding gene that plays important roles in various biological processes. WDR74 is involved in rRNA processing and ribosomal large subunit biogenesis. It is a 60S ribosome assembly factor, which is irreplaceable in ribosome biogenesis and is closely related to protein synthesis. WDR74 can induce nuclear β-catenin accumulation and activate Wnt-responsive genes, thus promoting cell proliferation and metastasis in various cancers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14617 Product name: Recombinant human WDR74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC006351 Sequence: MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQN Predict reactive species Full Name: WD repeat domain 74 Calculated Molecular Weight: 385 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC006351 Gene Symbol: WDR74 Gene ID (NCBI): 54663 RRID: AB_2878713 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6RFH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924