Proteintech, 20635-1-AP, PPAPDC3 Polyclonal antibody

Size: 20ul / 150ul The PPAPDC3 (20635-1-AP) by Proteintech is a Polyclonal antibody targeting PPAPDC3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 20635-1-AP targets PPAPDC3 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information PPAPDC3(Phosphatidic acid phosphatase type 2 domain-containing protein 3) is also named as C9orf67 and belongs to the PA-phosphatase related phosphoesterase family. It plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14676 Product name: Recombinant human PPAPDC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC006362 Sequence: MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQL Predict reactive species Full Name: phosphatidic acid phosphatase type 2 domain containing 3 Calculated Molecular Weight: 271 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC006362 Gene Symbol: PPAPDC3 Gene ID (NCBI): 84814 RRID: AB_10696180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.