Iright
BRAND / VENDOR: Proteintech

Proteintech, 20751-1-AP, NPT1 Polyclonal antibody

CATALOG NUMBER: 20751-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NPT1 (20751-1-AP) by Proteintech is a Polyclonal antibody targeting NPT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 20751-1-AP targets NPT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human placenta tissue, mouse kidney tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information NPT1 (also known as SLC17A1) is a member of sodium-dependent inorganic phosphate transporters (NPT), which regulates entrance into the cellular membrane. NPT1 is mainly expressed in the kidney transporting small organic anions such as PAH (para-aminohippurate), but it is also found in the liver and brain. NTP1 localizes to the apical membrane of renal proximal tubular cells. NPT1 exits two isoforms due to the alternative splicing. Western blot analysis using this antibody detected a major band around 45-55 kDa in kidney tissue. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12819 Product name: Recombinant human NPT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC101745 Sequence: MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYST Predict reactive species Full Name: solute carrier family 17 (sodium phosphate), member 1 Calculated Molecular Weight: 467 aa, 51 kDa Observed Molecular Weight: 50 kDa, 60-64 kDa GenBank Accession Number: BC101745 Gene Symbol: NPT1 Gene ID (NCBI): 6568 RRID: AB_10693677 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14916 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924