Proteintech, 20753-1-AP, ALG6 Polyclonal antibody

Size: 20ul / 150ul The ALG6 (20753-1-AP) by Proteintech is a Polyclonal antibody targeting ALG6 in WB, ELISA applications with reactivity to human, mouse, rat samples 20753-1-AP targets ALG6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ALG6 gene encodes an α-1,3-glucosyltransferase used to add the first glucose to the immature lipid-linked oligosaccharide (LLO) precursor. ALG6 has 14 transmembrane helices and two long loops (EL1 and EL4) that forms a large, hydrophilic cavity facing the ER lumen and a groove-shaped cavity facing the lipid bilayer (PMID: 21334936). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14176 Product name: Recombinant human ALG6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-125 aa of BC001253 Sequence: GLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLIYI Predict reactive species Full Name: asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) Calculated Molecular Weight: 507 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC001253 Gene Symbol: ALG6 Gene ID (NCBI): 29929 RRID: AB_10693678 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y672 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.