Proteintech, 20755-1-AP, ADAM20 Polyclonal antibody

Size: 20ul / 150ul The ADAM20 (20755-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM20 in WB, ELISA applications with reactivity to human, mouse samples 20755-1-AP targets ADAM20 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ADAM20 is the functional equivalent of sperm fertilin-alpha (ADAM1), since that gene is nonfunctional in human. And northern blot analysis detected the 2.8-kb ADAM20 mRNA only in testis. The exclusive expression of ADAM20 in human testis and their sequence similarity with the fertilins suggest that it is expressed on sperm cells and involved in sperm maturation and/or fertilization(PMID:9469942). The full length protein has a singnal peptide, propeptide and 6 glycosylation sites. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14493 Product name: Recombinant human ADAM20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 492-693 aa of BC025378 Sequence: HPGAACAFGICCKDCKFLPSGTLCRQQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVNAFCYEKTCNNHDIQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGTTYVKCWTPDIMCGRVQCENVGVIPNLIEHSTVQQFHLNDTTCWGTDYHLGMAIPDIGEVKDGTVCGPEKICIRKKCASMVHLSQACQPKTCNMR Predict reactive species Full Name: ADAM metallopeptidase domain 20 Calculated Molecular Weight: 776 aa, 87 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC025378 Gene Symbol: ADAM20 Gene ID (NCBI): 8748 RRID: AB_3669344 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43506 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.