Proteintech, 20759-1-AP, TMEM126A Polyclonal antibody

Size: 20ul / 150ul The TMEM126A (20759-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM126A in WB, IF/ICC, ELISA applications with reactivity to human samples 20759-1-AP targets TMEM126A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TMEM126A is a mitochondrial inner membrane protein that is enriched in the cristae. TMEM126A is necessary for Complex I assembly or stability.Complex I (CI) is the largest enzyme of the mitochondrial respiratory chain, and its defects are the main cause of mitochondrial disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14705 Product name: Recombinant human TMEM126A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-195 aa of BC007875 Sequence: AGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH Predict reactive species Full Name: transmembrane protein 126A Calculated Molecular Weight: 195 aa, 22 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC007875 Gene Symbol: TMEM126A Gene ID (NCBI): 84233 RRID: AB_3669345 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.