Proteintech, 20778-1-AP, WDR24 Polyclonal antibody

Size: 20ul / 150ul The WDR24 (20778-1-AP) by Proteintech is a Polyclonal antibody targeting WDR24 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 20778-1-AP targets WDR24 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissue, human colon tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information WDR24 is a component of the GATOR2 complex which has five known subunits (WDR24, WDR59, Mios, Sec13, and Seh1L). GATOR2 complex positively regulates mTORC1 signaling by acting upstream of or in parallel to GATOR1, which is a GTPase-activating protein (GAP) for RagA or RagB and an inhibitor of the amino-acid-sensing pathway. (PMID: 23723238; 25263562) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14774 Product name: Recombinant human WDR24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 440-790 aa of BC008025 Sequence: LGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS Predict reactive species Full Name: WD repeat domain 24 Calculated Molecular Weight: 920 aa, 102 kDa Observed Molecular Weight: 102 kDa, 88 kDa GenBank Accession Number: BC008025 Gene Symbol: WDR24 Gene ID (NCBI): 84219 RRID: AB_10696183 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.