Iright
BRAND / VENDOR: Proteintech

Proteintech, 20791-1-AP, GPR172B Polyclonal antibody

CATALOG NUMBER: 20791-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPR172B (20791-1-AP) by Proteintech is a Polyclonal antibody targeting GPR172B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20791-1-AP targets GPR172B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR172B, also known as solute carrier family 52 member 1 (SLC52A1) or riboflavin transporter 1 (RFT1), is a G protein-coupled receptor (GPCR) that plays a significant role in the transport of riboflavin, a vital component for the production of flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). GPR172B plays a role in cellular aging. Knockdown of GPR172B promotes senescence induced by DNA damage in both tumor and normal cells. The anti-senescence effect of GPR172B is dependent on its riboflavin transport activity, which leads to the activation of mitochondrial membrane potential (MMP) mediated by mitochondrial electron transport chain complex II, ultimately inhibiting the AMPK-p53 pathway, a central mediator of senescence-associated with mitochondrial dysfunction. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14525 Product name: Recombinant human GPR172B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-290 aa of BC060810 Sequence: TALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTS Predict reactive species Full Name: G protein-coupled receptor 172B Calculated Molecular Weight: 448 aa, 46 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC060810 Gene Symbol: GPR172B Gene ID (NCBI): 55065 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWF4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924