Iright
BRAND / VENDOR: Proteintech

Proteintech, 20803-1-AP, CLASP1 Polyclonal antibody

CATALOG NUMBER: 20803-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CLASP1 (20803-1-AP) by Proteintech is a Polyclonal antibody targeting CLASP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 20803-1-AP targets CLASP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, rat brain tissue, SH-SY5Y cells Positive IP detected in: HeLa cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CLASP1 is a member of CLASP family. Members of the CLASP family of proteins are involved in multiple MT-dependent processes, including Golgi complex organization and trafficking, kinetochore fiber dynamics and flux, mitotic spindle assembly, and the stabilization of MT plus ends near the cortex. CLASP proteins regulate MT dynamics by promoting MT rescue and suppressing MT catastrophe. Recent work showed that CLASP1 activity is required for proper positioning of the mitotic spindle in both the C. elegans embryo and mammalian cells. Recent work has also identified roles CLASP1 in the regulation of spindle positioning. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14724 Product name: Recombinant human CLASP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-238 aa of BC112940 Sequence: MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVNSSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMDQAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPNSQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSAND Predict reactive species Full Name: cytoplasmic linker associated protein 1 Calculated Molecular Weight: 1538 aa, 169 kDa Observed Molecular Weight: 162 kDa GenBank Accession Number: BC112940 Gene Symbol: CLASP1 Gene ID (NCBI): 23332 RRID: AB_10697808 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z460 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924