Proteintech, 20804-1-AP, ZNF622 Polyclonal antibody

Size: 20ul / 150ul The ZNF622 (20804-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF622 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20804-1-AP targets ZNF622 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, human brain tissue, mouse lung tissue Positive IHC detected in: human hepatocirrhosis tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14741 Product name: Recombinant human ZNF622 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-477 aa of BC008752 Sequence: MNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF Predict reactive species Full Name: zinc finger protein 622 Calculated Molecular Weight: 477 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC008752 Gene Symbol: ZNF622 Gene ID (NCBI): 90441 RRID: AB_10693628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969S3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.