Proteintech, 20811-1-AP, TXNDC17 Polyclonal antibody

Size: 20ul / 150ul The TXNDC17 (20811-1-AP) by Proteintech is a Polyclonal antibody targeting TXNDC17 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20811-1-AP targets TXNDC17 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, human kidney tissue, human uterus tissue, Jurkat cells, K-562 cells, L02 cells, mouse pancreas tissue Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TXNDC17 also known as TRP14, TXNL5, belongs to the thioredoxin family. TRP14 is a widely expressed, 123-amino acid protein with a WCPDC motif. TXNDC17 has a thioredoxin fold and a TRX-like active-site sequence(PMID: 14607844, 24778250). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14766 Product name: Recombinant human TXNDC17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC006405 Sequence: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED Predict reactive species Full Name: thioredoxin domain containing 17 Calculated Molecular Weight: 123 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC006405 Gene Symbol: TXNDC17 Gene ID (NCBI): 84817 RRID: AB_10695499 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.