Proteintech, 20828-1-AP, GLIPR1L1 Polyclonal antibody

Size: 20ul / 150ul The GLIPR1L1 (20828-1-AP) by Proteintech is a Polyclonal antibody targeting GLIPR1L1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20828-1-AP targets GLIPR1L1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14852 Product name: Recombinant human GLIPR1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-233 aa of BC014603 Sequence: SKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF Predict reactive species Full Name: GLI pathogenesis-related 1 like 1 Calculated Molecular Weight: 242 aa, 27 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC014603 Gene Symbol: GLIPR1L1 Gene ID (NCBI): 256710 RRID: AB_10732841 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UWM5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.