Proteintech, 20834-1-AP, SLC22A24 Polyclonal antibody

Size: 20ul / 150ul The SLC22A24 (20834-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A24 in WB, ELISA applications with reactivity to human, mouse, rat samples 20834-1-AP targets SLC22A24 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: H9C2 cells, mouse brain tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC22A24, an orphan transporter, belongs to the SLC22 family, which transports organic ions. SLC22A24 is conserved among higher order primates, but has diverged within lower level primates and other mammals. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14907 Product name: Recombinant human SLC22A24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC034394 Sequence: MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDSVSDNDTGTLSKDDLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCESQSLKSMVQSLFMAGS Predict reactive species Full Name: solute carrier family 22, member 24 Calculated Molecular Weight: 322 aa, 36 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC034394 Gene Symbol: SLC22A24 Gene ID (NCBI): 283238 RRID: AB_3085623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4F4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.