Proteintech, 20849-1-AP, DAX-1 Polyclonal antibody

Size: 20ul / 150ul The DAX-1 (20849-1-AP) by Proteintech is a Polyclonal antibody targeting DAX-1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20849-1-AP targets DAX-1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human small intestine tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14416 Product name: Recombinant human DAX-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 202-380 aa of BC011564 Sequence: CGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQAIKCFLSKCWSLNISTKEYAY Predict reactive species Full Name: nuclear receptor subfamily 0, group B, member 1 Calculated Molecular Weight: 470 aa, 52 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC011564 Gene Symbol: NR0B1 Gene ID (NCBI): 190 RRID: AB_2878751 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51843 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.