Iright
BRAND / VENDOR: Proteintech

Proteintech, 20852-1-AP, EZH1 Polyclonal antibody

CATALOG NUMBER: 20852-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EZH1 (20852-1-AP) by Proteintech is a Polyclonal antibody targeting EZH1 in WB, ELISA applications with reactivity to human, mouse samples 20852-1-AP targets EZH1 in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: RAW 264.7 cells, HL-60 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14732 Product name: Recombinant human EZH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 161-267 aa of BC015882 Sequence: EEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPN Predict reactive species Full Name: enhancer of zeste homolog 1 (Drosophila) Calculated Molecular Weight: 747 aa, 85 kDa Observed Molecular Weight: 80-95 kDa GenBank Accession Number: BC015882 Gene Symbol: EZH1 Gene ID (NCBI): 2145 RRID: AB_10863659 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92800 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924