Iright
BRAND / VENDOR: Proteintech

Proteintech, 20853-1-AP, THAP2 Polyclonal antibody

CATALOG NUMBER: 20853-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The THAP2 (20853-1-AP) by Proteintech is a Polyclonal antibody targeting THAP2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 20853-1-AP targets THAP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse testis tissue Positive IF/ICC detected in: Hela cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information THAP2, also named as THAP domain-containing protein 2, is a 228 amino acid protein, which contains one THAP-type zinc finger. Members of the THAP (thanatos-associated protein) family of proteins contain a well conserved DNA-binding domain known as the THAP-type zinc finger motif. Proteins containing the THAP-type zinc finger motif are commonly involved in transcriptional regulation, cell-cycle control, apoptosis and chromatin modification Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14775 Product name: Recombinant human THAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 83-228 aa of BC008358 Sequence: CTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI Predict reactive species Full Name: THAP domain containing, apoptosis associated protein 2 Calculated Molecular Weight: 228 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC008358 Gene Symbol: THAP2 Gene ID (NCBI): 83591 RRID: AB_10732806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0W7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924