Iright
BRAND / VENDOR: Proteintech

Proteintech, 20858-1-AP, TCERG1L Polyclonal antibody

CATALOG NUMBER: 20858-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TCERG1L (20858-1-AP) by Proteintech is a Polyclonal antibody targeting TCERG1L in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 20858-1-AP targets TCERG1L in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information TCERG1L, Transcription elongation regulator 1-like protein, is associated with plasma adiponectin, and plasma adiponectin is a key modulator of obesity, inflammation, IR and diabetes (PMID:22791750). Gene silencing of FBN2 and TCERG1L is associated with promoter DNA hypermethylation in CRC tumors and may be biomarkers for the early detection of CRC (PMID:22238052). Stra8 and TCERG1L play a role in retinoic acid induced spermatogonial differentiation in mouse (PMID:3395975). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14828 Product name: Recombinant human TCERG1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 337-545 aa of BC042951 Sequence: DLNRIIEDPPHKRKLEAPATDNSDGSSSEDNREDQDVKTKRNRTEGCGSPKPEEAKREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEKSKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNKFILILKKRDKENRLRLRKMR Predict reactive species Full Name: transcription elongation regulator 1-like Calculated Molecular Weight: 586 aa, 66 kDa GenBank Accession Number: BC042951 Gene Symbol: TCERG1L Gene ID (NCBI): 256536 RRID: AB_3085624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VWI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924