Proteintech, 20860-1-AP, ZCWPW1 Polyclonal antibody

Size: 20ul / 150ul The ZCWPW1 (20860-1-AP) by Proteintech is a Polyclonal antibody targeting ZCWPW1 in WB, ELISA applications with reactivity to human, mouse, rat samples 20860-1-AP targets ZCWPW1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14832 Product name: Recombinant human ZCWPW1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 128-477 aa of BC002725 Sequence: SGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYHVTFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERVNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPRGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPVALFGK Predict reactive species Full Name: zinc finger, CW type with PWWP domain 1 Calculated Molecular Weight: 648 aa, 72 kDa Observed Molecular Weight: 70-72 kDa GenBank Accession Number: BC002725 Gene Symbol: ZCWPW1 Gene ID (NCBI): 55063 RRID: AB_3085625 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0M4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.