Proteintech, 20866-1-AP, SLC15A3 Polyclonal antibody

Size: 20ul / 150ul The SLC15A3 (20866-1-AP) by Proteintech is a Polyclonal antibody targeting SLC15A3 in WB, ELISA applications with reactivity to human, mouse, rat samples 20866-1-AP targets SLC15A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Solute carrier family 15 member 3 (SLC15A3) is a proton-coupled amino-acid transporter, which transports free histidine and certain di- and tripeptides, and is involved in the innate immune response. It can transport carnosine as well (PMID:31073693). SLC15A3 has a calculated molecular weight of 64 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14915 Product name: Recombinant human SLC15A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-379 aa of BC037974 Sequence: MGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNFFPANPANISVALRAQGSSYTIPEAWLLLAN Predict reactive species Full Name: solute carrier family 15, member 3 Calculated Molecular Weight: 581 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC037974 Gene Symbol: SLC15A3 Gene ID (NCBI): 51296 RRID: AB_2935450 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IY34 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.