Iright
BRAND / VENDOR: Proteintech

Proteintech, 20868-1-AP, CALCR Polyclonal antibody

CATALOG NUMBER: 20868-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CALCR (20868-1-AP) by Proteintech is a Polyclonal antibody targeting CALCR in WB, ELISA applications with reactivity to human, mouse samples 20868-1-AP targets CALCR in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-12 cells, mouse brain tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The CALCR protein, also known as the calcitonin receptor, is a high-affinity receptor for the peptide hormone calcitonin and belongs to the subfamily of seven transmembrane-spanning G protein-coupled receptors. This protein plays a critical role in maintaining calcium homeostasis and regulating osteoclast-mediated bone resorption. The calcitonin receptor is involved in several physiological processes, including inhibition of osteoclastic bone resorption and increased renal calcium excretion, which helps to regulate Ca2+ concentrations. In addition, the CALCR protein has been detected in a variety of tissues not directly involved in the regulation of calcium homeostasis, with particular expression observed in the brain, suggesting distinct functions in the central nervous system (CNS) (PMID: 12730726). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14920 Product name: Recombinant human CALCR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-164 aa of BC075028 Sequence: AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLV Predict reactive species Full Name: calcitonin receptor Calculated Molecular Weight: 490 aa, 57 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC075028 Gene Symbol: CALCR Gene ID (NCBI): 799 RRID: AB_2878754 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30988 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924