Iright
BRAND / VENDOR: Proteintech

Proteintech, 20880-1-AP, TMEM243 Polyclonal antibody

CATALOG NUMBER: 20880-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM243 (20880-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM243 in IHC, IP, ELISA applications with reactivity to human samples 20880-1-AP targets TMEM243 in IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Ramos cells Positive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C7orf23, also known as TMEM243, encodes a membrane protein that may be associated with drug tolerance in cells. The C7orf23 gene is capable of generating at least 12 different splice variants, 10 of which are capable of encoding 7 different protein isoforms, some of which contain transmembrane structural domains. Recent studies have shown that C7orf23 is significantly up-regulated and highly sensitive in blood samples from PD patients, revealing its potential as a future biomarker for PD diagnosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14979 Product name: Recombinant human C7orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002837 Sequence: MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR Predict reactive species Full Name: chromosome 7 open reading frame 23 Calculated Molecular Weight: 118 aa, 13 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC002837 Gene Symbol: C7orf23 Gene ID (NCBI): 79161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BU79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924