Iright
BRAND / VENDOR: Proteintech

Proteintech, 20886-1-AP, AIFM2/ FSP1 Polyclonal antibody

CATALOG NUMBER: 20886-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AIFM2/ FSP1 (20886-1-AP) by Proteintech is a Polyclonal antibody targeting AIFM2/ FSP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20886-1-AP targets AIFM2/ FSP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells, rat liver tissue, HepG2 cells, PC-12 ceslls Positive IP detected in: L02 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis-associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis-Inducing Factor), a mitochondrion-associated enzyme that relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13412 Product name: Recombinant human AIFM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-373 aa of BC023601 Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Predict reactive species Full Name: apoptosis-inducing factor, mitochondrion-associated, 2 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC023601 Gene Symbol: AIFM2/ FSP1 Gene ID (NCBI): 84883 RRID: AB_2878756 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924