Iright
BRAND / VENDOR: Proteintech

Proteintech, 20887-1-AP, Caldesmon Polyclonal antibody

CATALOG NUMBER: 20887-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Caldesmon (20887-1-AP) by Proteintech is a Polyclonal antibody targeting Caldesmon in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples 20887-1-AP targets Caldesmon in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A2780 cells, HeLa cells, HT-1080 cells, MDA-MB-231 cells, PC-3 cells, SKOV-3 cells Positive IHC detected in: human colon tissue, mouse heart tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Caldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13676 Product name: Recombinant human CALD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 196-538 aa of BC040354 Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV Predict reactive species Full Name: caldesmon 1 Calculated Molecular Weight: 538 aa, 63 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC040354 Gene Symbol: CALD1 Gene ID (NCBI): 800 RRID: AB_10792408 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05682 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924