Iright
BRAND / VENDOR: Proteintech

Proteintech, 20895-1-AP, FBXL15 Polyclonal antibody

CATALOG NUMBER: 20895-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXL15 (20895-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL15 in WB, IHC, ELISA applications with reactivity to human samples 20895-1-AP targets FBXL15 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-453s cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBXL15, also known as FBXO37, belongs to the FBXL15 family. FBXL15 plays a role in the G2/M transition of the cell cycle, as well as in cellular protein metabolic processes and the positive regulation of the bone morphogenetic proteins signaling pathway (PMID: 38711244). The calculated molecular weight of FBXL15 is 33 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14949 Product name: Recombinant human FBXL15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC002912 Sequence: MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLAGLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVRTLAEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV Predict reactive species Full Name: F-box and leucine-rich repeat protein 15 Calculated Molecular Weight: 300 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC002912 Gene Symbol: FBXL15 Gene ID (NCBI): 79176 RRID: AB_2878758 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H469 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924