Proteintech, 20935-1-AP, KLHDC8B Polyclonal antibody

Size: 20ul / 150ul The KLHDC8B (20935-1-AP) by Proteintech is a Polyclonal antibody targeting KLHDC8B in WB, ELISA applications with reactivity to human samples 20935-1-AP targets KLHDC8B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, KG-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15028 Product name: Recombinant human KLHDC8B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-178 aa of BC039083 Sequence: AGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIY Predict reactive species Full Name: kelch domain containing 8B Calculated Molecular Weight: 354 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC039083 Gene Symbol: KLHDC8B Gene ID (NCBI): 200942 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.