Iright
BRAND / VENDOR: Proteintech

Proteintech, 20943-1-AP, SAP30BP Polyclonal antibody

CATALOG NUMBER: 20943-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SAP30BP (20943-1-AP) by Proteintech is a Polyclonal antibody targeting SAP30BP in WB, ELISA applications with reactivity to human, mouse samples 20943-1-AP targets SAP30BP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SAP30BP, also named as SAP30-binding protein, is a 308 amino acid protein, which belongs to the HCNGP family. SAP30BP localizes in Nucleus and Interacts with SAP30. DDX54 Induces cell death and may act as a transcriptional corepressor of a gene related to cell survival. SAP30BP may be involved in the regulation of beta-2-microglobulin genes. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15051 Product name: Recombinant human SAP30BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-308 aa of BC007592 Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ Predict reactive species Full Name: SAP30 binding protein Calculated Molecular Weight: 308 aa, 34 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC007592 Gene Symbol: SAP30BP Gene ID (NCBI): 29115 RRID: AB_2878770 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924