Iright
BRAND / VENDOR: Proteintech

Proteintech, 20948-1-AP, TRIM52 Polyclonal antibody

CATALOG NUMBER: 20948-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRIM52 (20948-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM52 in WB, IHC, ELISA applications with reactivity to human samples 20948-1-AP targets TRIM52 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, OVCAR-3 cells, SKOV-3 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TRIM52 (Tripartite motif 52) is a member of the family of highly conserved RBCC (a RING-finger, two B-boxes, and a predicted alpha-helical Coiled-Coil domain were linked to the N-terminal region in sequence) proteins with more than 70 isoforms, which plays an important role in tumorigenesis through different signaling pathways (PMID: 35837156). TRIM52 promotes tumorigenesis in ovarian cancer by activating the nuclear factor (NF)-κB signaling pathway. Knocking-down of TRIM52 in ovarian cancer cells suppresses cell invasion, cell migration and cell proliferation, while inducing apoptosis (PMID: 30918473, 28073078). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15064 Product name: Recombinant human TRIM52 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-297 aa of BC007372 Sequence: MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ Predict reactive species Full Name: tripartite motif-containing 52 Calculated Molecular Weight: 297 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC007372 Gene Symbol: TRIM52 Gene ID (NCBI): 84851 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924