Iright
BRAND / VENDOR: Proteintech

Proteintech, 20952-1-AP, ABHD14B Polyclonal antibody

CATALOG NUMBER: 20952-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ABHD14B (20952-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD14B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20952-1-AP targets ABHD14B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, mouse small intestine tissue Positive IHC detected in: human prostate hyperplasia tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ABHD14B possessed the canonical ABHD fold, an invariant catalytic triad (Ser-His-Asp), and based on its protein sequence, was subsequently categorized as an outlying member of the metabolic serine hydrolase family. ABHD14B was able to transfer an acetyl group from post translationally modified protein lysine residue to coenzyme-A (CoA), thus making the biologically important acetyl-CoA. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15097 Product name: Recombinant human ABHD14B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC007234 Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ Predict reactive species Full Name: abhydrolase domain containing 14B Calculated Molecular Weight: 210 aa, 22 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC007234 Gene Symbol: ABHD14B Gene ID (NCBI): 84836 RRID: AB_10733758 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IU4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924