Proteintech, 20953-1-AP, KCNJ1 Polyclonal antibody

Size: 20ul / 150ul The KCNJ1 (20953-1-AP) by Proteintech is a Polyclonal antibody targeting KCNJ1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 20953-1-AP targets KCNJ1 in WB, IP, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information KCNJ1, also called ROMK, is an inward-rectifying K+ channel responsible for basal (non-flow stimulated) K+ secretion. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium. This channel is activated by internal ATP and can be blocked by external barium. The calculated molecule weight is 45kDa, 20953-1-AP can detect the band around 75-80 kDa, it has been considered to be a dimer of KCNJ1.(PMID: 17804670; 7929082; 15767585) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15100 Product name: Recombinant human KCNJ1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 178-391 aa of BC074752 Sequence: ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM Predict reactive species Full Name: potassium inwardly-rectifying channel, subfamily J, member 1 Calculated Molecular Weight: 391 aa, 45 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC074752 Gene Symbol: KCNJ1 Gene ID (NCBI): 3758 RRID: AB_10732600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48048 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.