Proteintech, 20995-1-AP, TMEM106B (150-274aa) Polyclonal antibody

Size: 20ul / 150ul The TMEM106B (150-274aa) (20995-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM106B (150-274aa) in WB, IHC, ELISA applications with reactivity to human, mouse samples 20995-1-AP targets TMEM106B (150-274aa) in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. TMEM106B can be showed as 31-55 kDa and 70-90 kDa (Glycosylated or Dimer) form in western blot test. (PMID: 27543298, 22895706, PMID: 23136129). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14264 Product name: Recombinant human TMEM106B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-274 aa of BC033901 Sequence: LNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ Predict reactive species Full Name: transmembrane protein 106B Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31-35 kDa, 40-55 kDa GenBank Accession Number: BC033901 Gene Symbol: TMEM106B Gene ID (NCBI): 54664 RRID: AB_10694293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.