Iright
BRAND / VENDOR: Proteintech

Proteintech, 21001-1-AP, BZW2 Polyclonal antibody

CATALOG NUMBER: 21001-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BZW2 (21001-1-AP) by Proteintech is a Polyclonal antibody targeting BZW2 in WB, ELISA applications with reactivity to human samples 21001-1-AP targets BZW2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15126 Product name: Recombinant human BZW2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-355 aa of BC003056 Sequence: MKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIH Predict reactive species Full Name: basic leucine zipper and W2 domains 2 Calculated Molecular Weight: 419 aa, 48 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC003056 Gene Symbol: BZW2 Gene ID (NCBI): 28969 RRID: AB_2878787 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6E2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924