Proteintech, 21009-1-AP, CRYBB3 Polyclonal antibody

Size: 20ul / 150ul The CRYBB3 (21009-1-AP) by Proteintech is a Polyclonal antibody targeting CRYBB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21009-1-AP targets CRYBB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tisssue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15212 Product name: Recombinant human CRYBB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-158 aa of BC069479 Sequence: QGKRCELSAECPSLTDSLLEKVGSIQVESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTW Predict reactive species Full Name: crystallin, beta B3 Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC069479 Gene Symbol: CRYBB3 Gene ID (NCBI): 1417 RRID: AB_10732686 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26998 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.