Product Description
Size: 20ul / 150ul
The RNF170 (21024-1-AP) by Proteintech is a Polyclonal antibody targeting RNF170 in WB, IHC, ELISA applications with reactivity to human samples
21024-1-AP targets RNF170 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human placenta tissue
Positive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
RNF170 is an E3 ubiquitin ligase that resides in the endoplasmic reticulum (ER) membrane and mediates ubiquitination and processing of inositol 1,4,5-trisphosphate (IP3) receptors by the ER-associated protein degradation (ERAD) pathway. It has 6 isoforms produced by Alternative splicing with the molecular weight of 30 kDa, 27 kDa, 22 kDa, 20 kDa, 19 kDa, and 13 kDa.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15288 Product name: Recombinant human RNF170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC032393 Sequence: MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQT Predict reactive species
Full Name: ring finger protein 170
Calculated Molecular Weight: 258 aa, 30 kDa
Observed Molecular Weight: 27 kDa
GenBank Accession Number: BC032393
Gene Symbol: RNF170
Gene ID (NCBI): 81790
RRID: AB_10733119
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96K19
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924