Iright
BRAND / VENDOR: Proteintech

Proteintech, 21024-1-AP, RNF170 Polyclonal antibody

CATALOG NUMBER: 21024-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RNF170 (21024-1-AP) by Proteintech is a Polyclonal antibody targeting RNF170 in WB, IHC, ELISA applications with reactivity to human samples 21024-1-AP targets RNF170 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information RNF170 is an E3 ubiquitin ligase that resides in the endoplasmic reticulum (ER) membrane and mediates ubiquitination and processing of inositol 1,4,5-trisphosphate (IP3) receptors by the ER-associated protein degradation (ERAD) pathway. It has 6 isoforms produced by Alternative splicing with the molecular weight of 30 kDa, 27 kDa, 22 kDa, 20 kDa, 19 kDa, and 13 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15288 Product name: Recombinant human RNF170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC032393 Sequence: MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQT Predict reactive species Full Name: ring finger protein 170 Calculated Molecular Weight: 258 aa, 30 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC032393 Gene Symbol: RNF170 Gene ID (NCBI): 81790 RRID: AB_10733119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96K19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924