Proteintech, 21027-1-AP, MC3R Polyclonal antibody

Size: 20ul / 150ul The MC3R (21027-1-AP) by Proteintech is a Polyclonal antibody targeting MC3R in IHC, ELISA applications with reactivity to human, mouse samples 21027-1-AP targets MC3R in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15292 Product name: Recombinant human MC3R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC069599 Sequence: MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSL Predict reactive species Full Name: melanocortin 3 receptor Calculated Molecular Weight: 360 aa, 40 kDa GenBank Accession Number: BC069599 Gene Symbol: MC3R Gene ID (NCBI): 4159 RRID: AB_2878792 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41968 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.