Proteintech, 21030-1-AP, ARRDC1 Polyclonal antibody

Size: 20ul / 150ul The ARRDC1 (21030-1-AP) by Proteintech is a Polyclonal antibody targeting ARRDC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 21030-1-AP targets ARRDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HEK-293 exosomes, human plasma, human plasma exosomes Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ARRDC1, or Arrestin-Domain Containing Protein 1, is a protein that plays a significant role in the formation and release of extracellular vesicles, specifically a subtype known as ARMMs (Arrestin-Domain Containing Protein 1-mediated microvesicles). ARRDC1 is localized to the cytosolic side of the plasma membrane and recruits the ESCRT-I complex protein TSG101 to initiate outward membrane budding. This protein is also involved in the regulation of protein cargo and release of extracellular vesicles, including both exosomes and ectosomes. The absence of ARRDC1 can lead to changes in the protein cargo within these vesicles, indicating its importance in the sorting and packaging process. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15341 Product name: Recombinant human ARRDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 84-433 aa of BC032346 Sequence: HSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQSCGGVEPSLTPES Predict reactive species Full Name: arrestin domain containing 1 Calculated Molecular Weight: 433 aa, 46 kDa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: BC032346 Gene Symbol: ARRDC1 Gene ID (NCBI): 92714 RRID: AB_3085633 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5I2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.